PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.F01666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family ZF-HD
Protein Properties Length: 290aa    MW: 29920.3 Da    PI: 6.9151
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.F01666.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.52.8e-3262115458
     ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     +rY+eClkNhA+ +GghavDGCgEfm++ geeg+++al+CaACgCHRnFHR+e++
  Pahal.F01666.1  62 ARYRECLKNHAVGIGGHAVDGCGEFMAA-GEEGSIDALRCAACGCHRNFHRKESD 115
                     79*************************9.999********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047704.8E-2962114IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.0E-3063113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2463116IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.96364113IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.79E-21213287IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-33217288IPR009057Homeodomain-like
TIGRFAMsTIGR015659.3E-27226282IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MDFDEHDDGD GDEDMTPMPV TSSYDAPMQP GLGPGGGGGT PKPGDSGGGS FRTPGGGGGG  60
GARYRECLKN HAVGIGGHAV DGCGEFMAAG EEGSIDALRC AACGCHRNFH RKESDSPTGG  120
ASPADPTAAL SPAAITAYGA AAHHHPFSAY YRTPAGYLLH PHQQLAAAAA GHMQRPLALP  180
STSHSGRDEG DDMAGLIGPM MVAPMVGMSL GSGGGPSGCG GSGSGKKRFR TKFTQEQKDR  240
MLAFAEQLGW RIQKHDEAAV QQFCEEVGVK RQVLKVWMHN NKHTLGKKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A6e-302272841875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9632770.0EU963277.1 Zea mays clone 260287 ZF-HD protein dimerisation region containing protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149424.21e-147uncharacterized protein LOC100283050
SwissprotQ6ZB901e-122ZHD2_ORYSJ; Zinc-finger homeodomain protein 2
SwissprotA2YWA61e-122ZHD2_ORYSI; Zinc-finger homeodomain protein 2
TrEMBLA0A096TBY01e-147A0A096TBY0_MAIZE; Uncharacterized protein
STRINGGRMZM2G346920_P011e-146(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39503269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.11e-53homeobox protein 21